PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G049800.1
Common NamePHAVU_002G049800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 216aa    MW: 24582.2 Da    PI: 7.5818
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G049800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.64.3e-202063649
                        HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        k   qvtfskRr g++KKA+EL++LC++e+a+i+fs+ +k + +
  Phvul.002G049800.1 20 KGHLQVTFSKRRWGLFKKASELCTLCGVEIAIIVFSPADKAFSF 63
                        56679********************************9987655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.395767IPR002100Transcription factor, MADS-box
SMARTSM004325.4E-24766IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-14929IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.68E-231077IPR002100Transcription factor, MADS-box
PfamPF003191.1E-211663IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-142944IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-144465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MKKKCSSGCQ RIPIEKIPKK GHLQVTFSKR RWGLFKKASE LCTLCGVEIA IIVFSPADKA  60
FSFGHPEVES VIDSYVTPNS SLESNLGNGH QLVEAHRGAN IRNLNMQLTQ IVDELEMEKR  120
HGEELDRMWK TRQRQFWWEI PVNELGLQEL QHLVFSLEEL KNSVAKYATQ IMLMDQTTLA  180
PPITGPRPSG FGPYDVFDNK HAEIYPNNPN LNFPY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007157187.11e-162hypothetical protein PHAVU_002G049800g
TrEMBLV7CJX31e-162V7CJX3_PHAVU; Uncharacterized protein
STRINGGLYMA20G27350.23e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-50AGAMOUS-like 61